PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_94_iso_2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family MYB
Protein Properties Length: 339aa    MW: 37206.8 Da    PI: 9.1909
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_94_iso_2genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding63.34.6e-201459147
                                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                    Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                                       +g+W++eEdell ++v+++G+++W++I++ ++ gR++k+c++rw + 
  cra_locus_94_iso_2_len_1210_ver_3 14 KGPWSPEEDELLQQLVQKHGPRNWSLISKSIQ-GRSGKSCRLRWCNQ 59
                                       79******************************.***********985 PP

2Myb_DNA-binding55.51.3e-1768110347
                                        SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
                    Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                        ++T+eEde +++a++++G++ W+tIar +  gRt++ +k++w++ 
  cra_locus_94_iso_2_len_1210_ver_3  68 AFTPEEDETIIRAHARFGNK-WATIARLLS-GRTDNAIKNHWNST 110
                                        79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129427.759964IPR017930Myb domain
SuperFamilySSF466893.59E-3211107IPR009057Homeodomain-like
SMARTSM007172.0E-171362IPR001005SANT/Myb domain
PfamPF002497.6E-201459IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.9E-261567IPR009057Homeodomain-like
CDDcd001671.62E-161658No hitNo description
SMARTSM007171.2E-1465113IPR001005SANT/Myb domain
PROSITE profilePS5129421.22966115IPR017930Myb domain
CDDcd001675.60E-1268111No hitNo description
Gene3DG3DSA:1.10.10.602.5E-2368114IPR009057Homeodomain-like
PfamPF002497.7E-1568110IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0010200Biological Processresponse to chitin
GO:0046686Biological Processresponse to cadmium ion
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MSSNSMRKDV DRIKGPWSPE EDELLQQLVQ KHGPRNWSLI SKSIQGRSGK SCRLRWCNQL  60
SPQVEHRAFT PEEDETIIRA HARFGNKWAT IARLLSGRTD NAIKNHWNST LKRKCSSMSG  120
DEEGNDYSND LIQHQQPLKR SVSAGSAGPV SGGLYLSPGS PSGSDVSDSS LPNMSSSQLF  180
KPVARTGSVL PPQLETTTSS TNNNDDPPTS LSLSLPGIDP TESINRTNEL TQPKNPIQLL  240
PPSPPPSPPS APAPSPSLIQ QVSINPVAIP PQKAPIVPTA PVVVVQTPPV VAQQQDKVFV  300
PFSAELLAVM QEMIKKEVWS YMNMMGMERR QQQQQQQRX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C5e-411311457158MYB PROTO-ONCOGENE PROTEIN
1h89_C5e-411311457158MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00476DAPTransfer from AT4G37260Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099313.11e-134PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW11e-95MYB44_ARATH; Transcription factor MYB44
TrEMBLA0A0K1SB951e-130A0A0K1SB95_REHGL; R2R3-MYB protein
STRINGVIT_07s0129g01050.t011e-128(Vitis vinifera)